PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011093873.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family ARF
Protein Properties Length: 1078aa    MW: 120204 Da    PI: 6.6282
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011093873.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.82e-23126227199
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f+k+lt sd++++g +++p++ ae++      +++++  ++l+ +d++ ++W++++iyr++++r++lt+GW+ Fv++++L +gD v+F   ++++
  XP_011093873.1 126 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfSMQPPA-QELVARDLHDQTWTFRHIYRGQPKRHLLTTGWSVFVSSKRLVAGDAVLFI--RDEK 217
                     99*****************************9445444.38************************************************..4567 PP

                     E..EEEEE-S CS
              B3  90 felvvkvfrk 99 
                      +l+++++r+
  XP_011093873.1 218 SQLLLGIRRA 227
                     7789999997 PP

2Auxin_resp1262.5e-41252334183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     aahaa+++s+F+++YnPras+seFv++++k++ka++++vs+GmRf+m+fete+s  rr++Gt++gvsdldpvrW+nS+Wr+L+
  XP_011093873.1 252 AAHAAANNSPFTIFYNPRASPSEFVIPLAKYNKAMYTQVSPGMRFRMMFETEESGVRRYMGTITGVSDLDPVRWKNSQWRNLQ 334
                     79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.71E-45115255IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.5E-42119241IPR015300DNA-binding pseudobarrel domain
CDDcd100171.28E-21125226No hitNo description
PROSITE profilePS5086312.619126228IPR003340B3 DNA binding domain
SMARTSM010199.6E-24126228IPR003340B3 DNA binding domain
PfamPF023621.7E-21126227IPR003340B3 DNA binding domain
PfamPF065073.5E-36252334IPR010525Auxin response factor
PfamPF023095.5E-99481037IPR033389AUX/IAA domain
PROSITE profilePS5174526.3119511044IPR000270PB1 domain
SuperFamilySSF542771.18E-89551029No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0010311Biological Processlateral root formation
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 1078 aa     Download sequence    Send to blast
MKMPSNGFLA NSGEGEKKVI NSELWHACAG PLVCLPPVGS LVVYFPQGHS EQVAASMQKE  60
ADGIPSYPNL PSKLICMLHN VTLHADGETD EVYAQMTLQP VTKYDQEALL VSDIGLKHSR  120
QPAEFFCKTL TASDTSTHGG FSVPRRAAEK IFPPLDFSMQ PPAQELVARD LHDQTWTFRH  180
IYRGQPKRHL LTTGWSVFVS SKRLVAGDAV LFIRDEKSQL LLGIRRANRQ QPALSSSVIS  240
SDSMHIGILA AAAHAAANNS PFTIFYNPRA SPSEFVIPLA KYNKAMYTQV SPGMRFRMMF  300
ETEESGVRRY MGTITGVSDL DPVRWKNSQW RNLQVGWDES TAGERPSRVS IWDIEPVVTP  360
FYICPPPFFR PRFPKHPGFP DDDSDMENMF KRGMPWLADD FGLKDASSSI FPGLSLVQWM  420
SMQQNHQLSA NQSGFLPNMA ASNALTGNLG NDDQSKLLNF QSPGLVAPNL QVNKGNHQNQ  480
QVGQLMQSNI SWPQQQQQQL QQMLQSPSNT RQTQQLPLQQ TQPHLLQQTQ QQRFLQQTHQ  540
HQQQQSMLLP PSTSSLTADQ TVNQNLQQTA MYSQIQQQQI LTGTAQMQQN DLVTNRTTFP  600
MTSVPQDLPF QQHVEQPLQR SQEQQIQLQQ APLQVLQQSL AQRPQVQQTP PQSLPEQQLQ  660
MQLLQKLHQQ QQQQQLLSPL NPLLESQLPQ KQQAQQGQQT QNMSLPQQLN TSCFSASTLV  720
QSPQFPVNQF QGQQKNQLMG RSHSGRTDGD APSCSTSPSK NNLQVSQQNF LKNQTGPATL  780
LDSTIVHPPN LVQESNSKLD VRIKHELSSS KAPEQPKYKT NAADHMDVTS SATSYCLDAG  840
GLQQNFPLTG LDSDVQSHTR NSIPFTAGMD GLAPDALLSR GYDSGKDIHN LLSNYSGPPR  900
DIETELSSGI NSQSFGVPTM SFKPGCSNDA AINETAPLNG GLWPNQTQRM RTYTKVQKRG  960
SVGRTIDVTR YKGYDELRHD LARMFGIEGL LEDPQRTEWK LVYVDHENDI LLVGDDPWEE  1020
FVTCVQSIKI LSSAEVQQMS LDGDLGQLPV PNQACSGTDS GNAWRGHYDD NSATSFNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-175835539388Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0545741e-57KJ054574.1 Sesamum indicum clone TilSSR_25775 microsatellite Sesame_25775 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093873.10.0PREDICTED: auxin response factor 19
TrEMBLM4QSM60.0M4QSM6_CAMSI; Auxin response factor
STRINGfgenesh1_pg.C_scaffold_10017390.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13022465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19